PRDX4 (Peroxiredoxin-4, Antioxidant Enzyme AOE372, AOE37-2, Peroxiredoxin IV, Prx-IV, Thioredoxin Peroxidase AO372, Thioredoxin-dependent Peroxide Reductase A0372)

Size

£685.00

SKU:: 131755
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa51-150 from PRDX4 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2C12
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Probably involved in redox regulation of the cell. Regulates the activation of NF-kappa-B in the cytosol by a modulation of I-kappa-B-alpha phosphorylation. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: CHFFAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSV Storage and Stability: May be stored at 4°C. For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.