PRDM4 (PR Domain Zinc Finger Protein 4, PR Domain-containing Protein 4, PFM1)

Size

£685.00

SKU:: 131747
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa476-576 from human PRDM4 (NP_036538) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3E3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: PRDM4/PFM1 may function as a transcription factor involved in cell differentiation. It contains 6 C2H2-type zinc fingers and is expressed in many tissues. Highly expressed in ovary, testis, pancreas, brain, heart and prostate. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 1.5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: IITTDENECNWMMFVRKARNREEQNLVAYPHDGKIFFCTSQDIPPENELLFYYSRDYAQQIGVPEHPDVHLCNCGKECNSYTEFKAHLTSHIHNHLPTQG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.