PRDM1 (PR Domain Zinc Finger Protein 1, BLIMP-1, Beta-interferon Gene Positive Regulatory Domain I-binding Factor, PR Domain-containing Protein 1, Positive Regulatory Domain I-binding Factor 1, PRDI-BF1, PRDI-binding Factor 1, BLIMP1)

Size

£685.00

SKU:: 131745
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-109 from human PRDM1 (NP_001189) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2B10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Transcriptional repressor that binds specifically to the PRDI element in the promoter of the beta-interferon gene. Drives the maturation of B-lymphocytes into Ig secreting cells. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.