PPP1R9A (Neurabin-1, Neurabin-I, Neural Tissue-specific F-actin-binding Protein I, Protein Phosphatase 1 Regulatory Subunit 9A, KIAA1222, FLJ20068)

Size

£685.00

SKU:: 131708
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1090-1189 from human PPP1R9A (XP_371933) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6A10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Binds to actin filaments (F-actin) and shows cross-linking activity. Binds along the sides of the F-actin. May be involved in neurite formation. Inhibits protein phosphatase 1-alpha activity. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PCSTAQTSTRSPCMPFSWFNDSRKGSYSFRNLPAPTSSLQPSPETLISDKKGSKNFTFNDDFSPSSTSSADLSGLGAEPKTPGLSQSLALSSDESLDMI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.