POU4F3 (POU Domain, Class 4, Transcription Factor 3, Brain-specific Homeobox/POU Domain Protein 3C, Brain-3C, Brn-3C, BRN3C, MGC138412)

Size

£685.00

SKU:: 131629
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa100-191 from human POU4F3 (NP_002691) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5B8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: May play a role in determining or maintaining the identities of a small subset of visual system neurons. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.