POU2F3 (POU Domain, Class 2, Transcription Factor 3, Octamer-binding Protein 11, Oct-11, Octamer-binding Transcription Factor 11, OTF-11, Transcription Factor PLA-1, Transcription Factor Skn-1, OTF11, PLA1)

Size

£685.00

SKU:: 131624
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-110 from human POU2F3 (NP_055167) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6D1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Regulated the expression of a number of genes such as SPRR2A or placental lactogen. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MVNLESMHTDIKMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.