131614-APC

POP7 (Ribonuclease P Protein Subunit p20, RNaseP Protein p20, Ribonucleases P/MRP Protein Subunit POP7 Homolog, hPOP7, RPP20, 0610037N12Rik) (APC)

Size

£927.00

SKU:: 131614-APC
Application:: FLISA
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-80 from POP7 (NP_005828) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3F12
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINH Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.