POLR2H (DNA-directed RNA Polymerases I, II, and III Subunit RPABC3, DNA-directed RNA Polymerase II Subunit H, DNA-directed RNA Polymerases I, II, and III 17.1kD Polypeptide, RPB17, RPB8 Homolog)

Size

£685.00

SKU:: 131589
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-151 from human POLR2H (AAH00739) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3G6-1A4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: This gene encodes one of the essential subunits of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.