131588
POLR2H (DNA-directed RNA Polymerases I, II, and III Subunit RPABC3, DNA-directed RNA Polymerase II Subunit H, DNA-directed RNA Polymerases I, II, and III 17.1kD Polypeptide, RPB17, RPB8 Homolog) (Not for Export EU)
Size
£760.00
- SKU:
- 131588
- Application:
- IP
- Purity:
- Serum
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human POLR2H, aa1-150 (NP_006223.2).
- Format:
- Supplied as a liquid.
- Extra Details:
- This gene encodes one of the essential subunits of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III. Applications: Suitable for use in Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice