POLE3 (DNA Polymerase epsilon Subunit 3, Arsenic-transactivated Protein, AsTP, Chromatin Accessibility Complex 17kD Protein, CHRAC-17, HuCHRAC17, DNA Polymerase II Subunit 3, DNA Polymerase epsilon Subunit p17, CHRAC17)

Size

£760.00

SKU:: 131569
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human POLE3, aa1-147 (AAH03166.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: POLE3 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQNEEEEVDN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.