POLD4 (DNA Polymerase delta Subunit 4, DNA Polymerase delta Subunit p12, POLDS)

Size

£698.00

SKU:: 131564
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-35 from human POLD4 (AAH01334) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2B11
Format:: Supplied as a liquid in ascites fluid.
Extra Details:: Required for optimal DNA polymerase delta activity. May contribute to PCNA-dependent activity of DNA polymerase delta. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.