131545-ML650
PNPLA2 (PEDFR, Patatin-like Phospholipase Domain Containing 2, 1110001C14Rik, Adipose Triglyceride Lipase, ATGL, Calcium-independent Phospholipase A2, Desnutrin, DKFZp667M109, FP17548, IPLA2-zeta, Patatin-like Phospholipase Domain-containing Protein 2 Pigment Epithelium-derived Factor, Transport-secretion Protein 2, TTS2, TTS2.2, TTS-2.2) (MaxLight 650)
Size
£914.00
- SKU:
- 131545-ML650
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa347-447 from human PNPLA2 (NP_065109) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2H1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. Triglycerides are the most efficient form of energy storage in mammalian adipose tissue during times of caloric excess. ATGL is one of the key enzymes involved in the mobilization of fatty acids from triglyceride stores in adipose tissue, catalyzing the conversion of triacylglycerols to diacylglycerols. Inhibition of ATGL markedly decreases total adipose acyl-hydrolase activity, and thus may be a potential drug target for the diabetic pathology. ATGL mRNA is detected in a wide range of tissues including adipose, lung, skeletal muscle, testis, heart, brain, and kidney, with adipose tissue expressing the highest level. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SFTIRLLEWLPDVPEDIRWMKEQTGSICQYLVMRAKRKLGRHLPSRLPEQVELRRVQSLPSVPLSCAAYREALPGWMRNNLSLGDALAKWEECQRQLLLG Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice