PML (Probable Transcription Factor PML, RING Finger Protein 71, Tripartite Motif-containing Protein 19, PML, MYL, RNF71, TRIM19)

Size

£685.00

SKU:: 131515
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa411-510 from human PML (AAH00080) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1D12
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: PML protein is a zinc finger transcription factor expressed as three major transcription products due to alternative splicing. The t(15;17)(q22;q11-q12) chromosomal trans-location of the retinoic acid receptor alpha gene occurs in virtually all cases of acute promyelocytic leukemia. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: RDPIDVDLDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.