PLXNC1 (VESPR, Plexin-C1, Virus-encoded Semaphorin Protein Receptor, CD232)

Size

£685.00

SKU:: 131509
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa250-348 from PLXNC1 (NP_005752) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1A12
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: PLXNC1 is a receptor for vaccinia virus semaphorin A39R and for Herpes virus Sema protein. Binding of viral semaphorins triggers cellular responses leading to the rearrangement of the cytoskeleton and to secretion of IL6 and IL8 (By similarity). Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PYNYTSGAATGWPSMARIAQSTEVLFQGQASLDCGHGHPDGRRLLLSSSLVEALDVWAGVFSAAAGEGQERRSPTTTALCLFRMSEIQARAKRVSWDFK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.