PLEKHO2 (PP9099, PLEKHQ1, Pleckstrin Homology Domain-containing Family O Member 2, PH Domain-containing Family O Member 2, Pleckstrin Homology Domain-containing Family Q Member 1, PH Domain-containing Family Q Member 1)

Size

£685.00

SKU:: 131466
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa392-491 from human pp9099 (NP_079477) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3D9
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GDLLGEGPRHPLQPRERLYRAQLEVKVASEQTEKLLNKVLGSEPAPVSAETLLSQAVEQLRQATQVLQEMRDLGELSQEAPGLREKRKELVTLYRRSAP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.