131446-FITC
PLEC1 (Plectin, PCN, PLTN, Hemidesmosomal Protein 1, HD1, Plectin-1, PLEC) (FITC)
Size
£914.00
- SKU:
- 131446-FITC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa4384-4494 from human PLEC1 (NP_000436) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4D12
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Extra Details:
- Plectin is a 500kD ubiquitously expressed intermediate filament binding protein and member of the plakin family, which acts as a link between intermediate filaments (IF), microtubules and actin microfilaments within the cytoskeleton, and between the cytoskeleton and plasma membranes connecting different cells, thereby maintaining tissue integrity. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: CGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVPLDEALQRGTVDARTAQKLRDVGAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice