PLAA (Phospholipase A-2-activating Protein, PLA2P, PLAP, FLJ11281, FLJ12699)

Size

£685.00

SKU:: 131429
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa639-738 from PLaa (NP_004244) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2C1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: PLAA stimulates human neutrophil aggregation and release of lysosomal enzymes, superoxide, and eicosanoids. It plays an important role in the regulation of specific inflammatory processes connected to such diseases as inflammatory bowel disease, pancreatitis, rheumatoid arthritis, and cutaneous malignant melanoma. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KNIHIALATLALNYSVCFHKDHNIEGKAQCLSLISTILEVVQDLEATFRLLVALGTLISDDSNAVQLAKSLGVDSQIKKYSSVSEPAKVSECCRFILNLL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.