PKNOX2 (PREP2, Homeobox Protein PKNOX2, Homeobox Protein PREP-2, PBX/Knotted Homeobox 2, FLJ13074)

Size

£685.00

SKU:: 131408
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa116-216 from human PKNOX2 (NP_071345) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4B6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Homeodomain proteins are sequence-specific transcription factors that share a highly conserved DNA-binding domain and play fundamental roles in cell proliferation, differentiation, and death. PKNOX2 belongs to the TALE (3aa loop extension) class of homeodomain proteins characterized by a 3aa extension between alpha helices 1 and 2 within the homeodomain (Imoto et al., 2001 [PubMed 11549286]). Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PELDNLMVKAIQVLRIHLLELEKVNELCKDFCNRYITCFKTKMHSDNLLRNDLGGPYSPNQPSINLHSQDLLQNSPNSMSGVSNNPQGIVVPASALQQGN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.