131408-APC
PKNOX2 (PREP2, Homeobox Protein PKNOX2, Homeobox Protein PREP-2, PBX/Knotted Homeobox 2, FLJ13074) (APC)
Size
£927.00
- SKU:
- 131408-APC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa116-216 from human PKNOX2 (NP_071345) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4B6
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Extra Details:
- Homeodomain proteins are sequence-specific transcription factors that share a highly conserved DNA-binding domain and play fundamental roles in cell proliferation, differentiation, and death. PKNOX2 belongs to the TALE (3aa loop extension) class of homeodomain proteins characterized by a 3aa extension between alpha helices 1 and 2 within the homeodomain (Imoto et al., 2001 [PubMed 11549286]). Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PELDNLMVKAIQVLRIHLLELEKVNELCKDFCNRYITCFKTKMHSDNLLRNDLGGPYSPNQPSINLHSQDLLQNSPNSMSGVSNNPQGIVVPASALQQGN Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice