PKLR (Pyruvate Kinase Isozymes R/L, Pyruvate Kinase 1, R-type/L-type Pyruvate Kinase, Red Cell/Liver Pyruvate Kinase, PK1, PKL)

Size

£685.00

SKU:: 131395
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa485-575 from human PKLR (AAH25737) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3B11
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: PKLR is a pyruvate kinase that catalyzes the production of phosphoenolpyruvate from pyruvate and ATP. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA). Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLSIS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.