PKDCC (LOC91461, Protein Kinase Domain-containing Protein, Cytoplasmic, Protein Kinase-like Protein SgK493, Sugen Kinase 493, Vertebrate Lonesome Kinase, SGK493, VLK, FLJ18197, MGC125960)

Size

£685.00

SKU:: 131390
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length human LOC91461, aa1-294 (NP_612379.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Protein kinase which is required for longitudinal bone growth through regulation of chondrocyte differentiation. Involved in protein transport from the Golgi apparatus to the plasma membrane. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MVLLERLRHPNVLQLYGYCYQDSEDIPDTLTTITELGAPVEMIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVDGELKVTDLDDARVEETPCAGSTDCILEFPARNFTLPCSAQGWCEGMNEKRNLYNAYRFFFTYLLPHSAPPSLRPLLDSIVNATGELAWGVDETLAQLEKVLHLYRSGQYLQNSTASSSTEYQCIPDSTIPQEDYRCWPSYHHGSCLLSVFNLAEAVDVCESHAQCRAFVVTNQTTWTGRQLVFFKTGWSQVVPDPNKTTYVKASG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.