131388-ML650
PKD2 (Polycystin-2, Autosomal Dominant Polycystic Kidney Disease Type II Protein, Polycystic Kidney Disease 2 Protein, Polycystwin, R48321) (MaxLight 650)
Size
£914.00
- SKU:
- 131388-ML650
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa261-360 from human PKD2 with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4C8
- Format:
- Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. Protein kinase D (PKD), a serine/threonine kinase originally described as a novel PKC family member and termed PKCm, belongs to the calcium calmodulin superfamily of kinases. Three mammalian isoforms have so far been described - PKD1/PKCu, PKD2 and PKD3/PKCν; these isoforms show a high degree of homology, especially in their catalytic domain. PKDs are major targets for tumor promoting phorbol esters; they are activated via G protein-coupled receptors (GPCRs) and their activation is also dependent on PKC activation. PKDs have been implicated in numerous cellular functions, including signal transduction as well as cell survival, migration, differentiation, and proliferation. They are important regulators of secretory transport at the trans- golgi network. Of the three isoforms, PKD1 is the best characterized. It is involved in the regulation of Golgi function, cell proliferation and apoptosis and it mediates oxidative stress signaling regulating cellular detoxification and survival. PKD2 has been found to phosphorylate histone H1 more efficiently than aldolase in vitro. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGP Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice