PJA2 (KIAA0438, RNF131, E3 Ubiquitin-protein Ligase Praja-2, RING Finger Protein 131)

Size

£685.00

SKU:: 131384
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa302-400 from PJA2 (NP_055634) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1G11
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: PJA2 has E2-dependent E3 ubiquitin-protein ligase activity (By similarity). Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: REKNHGSSPEQVVRPKVRKLISSSQVDQETGFNRHEAKQRSVQRWREALEVEESGSDDLLIKCEEYDGEHDCMFLDPPYSRVITQRETENNQMTSESGA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.