PIPOX (Peroxisomal Sarcosine Oxidase, PSO, L-pipecolate Oxidase, L-pipecolic Acid Oxidase, LPIPOX, PSO)

Size

£685.00

SKU:: 131368
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa292-384 from human PIPOX (AAH27622.1) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3D1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Metabolizes sarcosine, L-pipecolic acid and L-proline. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IGDVQILSSFVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHGFKLAPVVGKILYELSMKLTPSYDLAPFRISRFPG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.