PIM3 (Serine/Threonine-protein Kinase Pim-3)

Size

£685.00

SKU:: 131352
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa242-326 from human PIM3 (NP_001001852) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4A9
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: PIM3 is a memberof the Ser/Thr protein kinase family that may be involved in cell cycle progression and anti-apoptosis process. This protein has been implicated in proliferation of human hepatoma cell lines. PIM3 is widely expressed, with the exception of no expression observed in colon, thymus, and small intestine. PIM3 is expressed in human hepatoma cell lines but not in normal liver tissues. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: DIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGAPESCDLRLCTLDPDDVASTTSSSESL* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.