131347-PE

PIK3R3 (Phosphatidylinositol 3-kinase Regulatory Subunit gamma, PI3-kinase Regulatory Subunit gamma, PI3K Regulatory Subunit gamma, PtdIns-3-kinase Regulatory Subunit gamma, Phosphatidylinositol 3-kinase 55kD Regulatory Subunit gamma, PI3-kinase Subunit p55-gamma, PtdIns-3-kinase Regulatory Subunit p55-gamma, p55PIK, DKFZp686P05226, FLJ41892) (PE)

Size

£914.00

SKU:: 131347-PE
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa271-381 from PIK3R3 (AAH21622) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2F8
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: Binds to activated (phosphorylated) protein-tyrosine kinases through its SH2 domain and regulates their kinase activity. During insulin stimulation, it also binds to IRS-1. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HDSKMRLEQDLKNQALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDAAENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAF* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.