PIGB (GPI Mannosyltransferase 3, GPI Mannosyltransferase III, GPI-MT-III, PIG-B, Phosphatidylinositol-glycan Biosynthesis Class B Protein)

Size

£685.00

SKU:: 131320
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa80-172 from PIGB (NP_004846) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2G7
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Mannosyltransferase involved in glycosylphosphatidylinositol-anchor biosynthesis. Transfers the third alpha-1,2-mannose to Man2-GlcN-acyl-PI during GPI precursor assembly. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TSFVPDEYWQSLEVSHHMVFNYGYLTWEWTERLRSYTYPLIFASIYKILHLLGKDSVQLLIWIPRLAQALLSAVADVRLYSLMKQLENQEVAR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.