131304
PI4KB (PIK4CB, Phosphatidylinositol 4-kinase beta, PI4K-beta, PI4Kbeta, PtdIns 4-kinase beta, NPIK, PI4K92)
Size
£685.00
- SKU:
- 131304
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa731-828 from human PIK4CB with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3B1
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- Phosphoinositides are pivotal precursors to important second messengers and as signaling and molecules. Phosphatidylinositol 4-kinases (PI4Ks) are are crucial regulators of the phosphoinsitide cascade. PI4KCB is a wortmannin-sensitive PI 4-kinase responsible for regulating the synthesis of agonist-sensitive pools of polyphosphoinositides. The cellular reservoir of PI4KCB is predominantly cytosolic, however the protein is is activated strongly by recruitment to the membrane to stimulate phosphatidylinositol 4,5-bisphosphate synthesis at the plasma membrane. PI4KCB contains an N-terminal lipid kinase unique domain, which is shared by members of both the PI3 kinase and PI4 kinase families, and a C-terminal catalytic domain, which defines this protein as a member of a much larger protein/lipid kinase family. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: GGLDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice