131304-BIOTIN
PI4KB (PIK4CB, Phosphatidylinositol 4-kinase beta, PI4K-beta, PI4Kbeta, PtdIns 4-kinase beta, NPIK, PI4K92) (Biotin)
Size
£914.00
- SKU:
- 131304-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa731-829 from human PIK4CB with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3B1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- Phosphoinositides are pivotal precursors to important second messengers and as signaling and molecules. Phosphatidylinositol 4-kinases (PI4Ks) are are crucial regulators of the phosphoinsitide cascade. PI4KCB is a wortmannin-sensitive PI 4-kinase responsible for regulating the synthesis of agonist-sensitive pools of polyphosphoinositides. The cellular reservoir of PI4KCB is predominantly cytosolic, however the protein is is activated strongly by recruitment to the membrane to stimulate phosphatidylinositol 4,5-bisphosphate synthesis at the plasma membrane. PI4KCB contains an N-terminal lipid kinase unique domain, which is shared by members of both the PI3 kinase and PI4 kinase families, and a C-terminal catalytic domain, which defines this protein as a member of a much larger protein/lipid kinase family. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: GGLDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice