131290-ML550

Phospholipase C, gamma 1 (Phospholipase C-gamma-1, PLCgamma1, PLC-gamma-1, PLCg1, NCKAP3, 1-Phosphatidylinositol-4,5-bisphosphate Phosphodiesterase gamma-1, Phospholipase C-II, PLC-II, Phosphoinositide Phospholipase C-gamma-1, PLC1, PLC148, PLC-148) (MaxLight 550)

Size

£914.00

SKU:: 131290-ML550
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1192-1292 from human PLCG1 (NP_002651) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2A2
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Extra Details:: MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. Phosphoinositide-specific phospholipase C (PLC) plays a significant role in transmembrane signaling. In response to extracellular stimuli such as hormones, growth factors and neurotransmitters, PLC hydrolyzes phosphatidylinositol 4,5-bisphosphate (PIP2) to generate two secondary messengers: inositol 1,4,5-triphosphate (IP3) and diacylglycerol (DAG). At least four families of PLCs have been identified: PLCb, PLCy, PLCd, and PLCe. Phosphorylation is one of the key mechanisms that regulate the activity of PLC. PLCy is activated by both receptor and non-receptor tyrosine kinases. PLCy forms a complex with EGF and PDGF receptors, which leads to the phosphorylation of PLCy at Tyr771, 783 and 1245. Phosphorylation by Syk at Tyr783 activates the enzymatic activity of PLCy1. PLCy2 is engaged in antigen-dependent signaling in B-cells and collagen-dependent signaling in platelets. Phosphorylation by Btk or Lck at Tyr753, 759, 1197 and 1217 is correlated with PLCy2 activity. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 40ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice