Phosphodiesterase 8A (PDE8A, High Affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic Phosphodiesterase 8A, FLJ16150, HsT19550)

Size

£685.00

SKU:: 131279
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa32-122 from human PDE8A (NP_002596) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1H6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Phosphodiesterase 8A, a high affinity, cAMP-specific phosphodiesterase, has been implicated in penile erectile dysfunction. PDE8A activity is inhibited by dipyridamole, but not by rolipram, zaprinast, or IBMX. At least five splice variants and four protein isoforms have been reported. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACFL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.