PHLDA2 (Pleckstrin Homology-like Domain Family A Member 2, Beckwith-Wiedemann Syndrome Chromosomal Region 1 Candidate Gene C Protein, Imprinted in Placenta and Liver Protein, Tumor-suppressing STF cDNA 3 Protein, Tumor-suppressing Subchromosomal Transferable Fragment Candidate Gene 3 Protein, p17-Beckwith-Wiedemann Region 1 C, p17-BWR1C, BWR1C, HLDA2, IPL, TSSC3)

Size

£685.00

SKU:: 131276
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-110 from human PHLDA2 (NP_003302) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5E3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: This gene is located in a cluster of imprinted genes on chromosome 11p15.5, which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene has been shown to be imprinted, with preferential expression from the maternal allele in placenta and liver. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.