PHF2 (PHD Finger Protein 2, GRC5, KIAA0662, MGC176680)

Size

£698.00

SKU:: 131253
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa2-101 from human PHF2 (NP_005383) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3E7
Format:: Supplied as a liquid in ascites fluid.
Extra Details:: Reacts with the novel (plant homeodomain)/ LAP (leukemia-associated protein) PHD finger protein PHF-2. PHF-2 is widely expressed and is implicated in hereditary sensory neuropathy type 1 HSN1. Human PHF-2 is 1099aa protein, and migrates at ~120kD in SDS-PAGE gels. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ATVPVYCVCRLPYDVTRFMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNCEKTHGKSTLKKKRTWHKHGPGQAPDVKPVQNGSQLFIKELRSRTFPS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.