PGA5 (Pepsin A-5, Pepsinogen-5)

Size

£685.00

SKU:: 131197
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa203-306 from human PGA5 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4G9
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Pepsins are aspartic proteases that are synthesized in the gastric mucosa and secreted into the stomach. They are released as zymogens called pepsinogens and then converted to active pepsins by the acidic pH of gastric juices. PGA 3, PGA4, and PGA5 are human Pepsinogen A isozymogens that differ in sequence by 2-4aa. Human PGA5 cDNA encodes 388aa including a 15aa signal sequence, a 47aa activation peptide, and a 326aa active enzyme. Human pepsinogen A isozymogens share ~56% aa sequence identity with mouse and rat pepsinogen A isozymogens. Pepsins have optimal activity under conditions of acidic pH and are inhibited by pepstatin. Pepsin A has broad substrate specificity, but preferentially cleaves peptide bonds involving aromatic and aliphatic aa's. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: WNQGLVSQDLFSVYLSADDKSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGETIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice