131197-ML650
PGA5 (Pepsin A-5, Pepsinogen-5) (MaxLight 650)
Size
£914.00
- SKU:
- 131197-ML650
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa203-306 from human PGA5 (NM_014224, NP_055039) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4G9
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. Pepsins are aspartic proteases that are synthesized in the gastric mucosa and secreted into the stomach. They are released as zymogens called pepsinogens and then converted to active pepsins by the acidic pH of gastric juices. PGA 3, PGA4, and PGA5 are human Pepsinogen A isozymogens that differ in sequence by 2-4aa. Human PGA5 cDNA encodes 388aa including a 15aa signal sequence, a 47aa activation peptide, and a 326aa active enzyme. Human pepsinogen A isozymogens share ~56% aa sequence identity with mouse and rat pepsinogen A isozymogens. Pepsins have optimal activity under conditions of acidic pH and are inhibited by pepstatin. Pepsin A has broad substrate specificity, but preferentially cleaves peptide bonds involving aromatic and aliphatic aa's. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: WNQGLVSQDLFSVYLSADDKSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGETIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGD Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice