131191-BIOTIN
PFKM (6-phosphofructokinase, Muscle Type, Phosphofructokinase 1, Phosphohexokinase, Phosphofructo-1-kinase Isozyme A, PFK-A, Phosphofructokinase-M, PFKX, MGC8699) (Biotin)
Size
£914.00
- SKU:
- 131191-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa681-781 from human PFKM (NP_000280) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1D1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- Phosphofructokinase catalyzes the irreversible conversion of fructose 6 phosphate to fructose 1,6 bisphosphate. Mammalian PFK is a complex isozyme consisting of 3 subunits: muscle (M), liver (L), and platelet (P). Only M type PFK isozyme is expressed in mature muscle, while erythrocytes contain both L and M subunits. Defects in PFKM are the cause of glycogen storage disease type 7 (GSD7), also known as Tarui disease. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVFQPVAELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEHITRKRSGEAAV Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice