131191-APC

PFKM (6-phosphofructokinase, Muscle Type, Phosphofructokinase 1, Phosphohexokinase, Phosphofructo-1-kinase Isozyme A, PFK-A, Phosphofructokinase-M, PFKX, MGC8699) (APC)

Size

£927.00

SKU:: 131191-APC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa681-781 from human PFKM (NP_000280) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1D1
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: Phosphofructokinase catalyzes the irreversible conversion of fructose 6 phosphate to fructose 1,6 bisphosphate. Mammalian PFK is a complex isozyme consisting of 3 subunits: muscle (M), liver (L), and platelet (P). Only M type PFK isozyme is expressed in mature muscle, while erythrocytes contain both L and M subunits. Defects in PFKM are the cause of glycogen storage disease type 7 (GSD7), also known as Tarui disease. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVFQPVAELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEHITRKRSGEAAV Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice