131161-APC

PET112L (Glutamyl-tRNA(Gln) Amidotransferase Subunit B, Mitochondrial, Glu-AdT Subunit B, Cytochrome C Oxidase Assembly Factor PET112 Homolog, PET112, HSPC199) (APC)

Size

£927.00

SKU:: 131161-APC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa466-557 from human PET112L (NP_004555) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6B2
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln). Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SAAKQVFEELWKREGKTPGQIVSEKQLELMQDQGALEQLCHSVMEAHPQVVMDVKNRNPRAINKLIGLVRKATQSRADPVMIKEILEKKLS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.