RHOXF2 (Rhox Homeobox Family Member 2, Paired-like Homeobox Protein PEPP-2, Testis Homeobox Gene 1, PEPP2, THG1, CT107)

Size

£685.00

SKU:: 131152
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-100 from human PEPP-2 (NP_115887) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1G6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: RHOXF2 (Rhox homeobox family member 2) belongs to the paired like homeobox family. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEPPDQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEVKEEEEDAQPEPEQGTAAGEKLKSAGAQGGEEKDGGGEEKDGGGAGVPGHLWEGDLEGTSGS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.