PECR (Peroxisomal Trans-2-enoyl-CoA Reductase, 2,4-dienoyl-CoA Reductase-related Protein, HPDHase, pVI-ARL, HSA250303, SDR29C1, TERP, DCRRP, DCR-RP, HPDHASE, PRO1004, PVIARL)

Size

£698.00

SKU:: 131138
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-304 from human PECR with GST tag.
Clone:: 2F10
Format:: Supplied as a liquid in ascites fluid.
Extra Details:: Participates in chain elongation of fatty acids. Has no 2,4-dienoyl-CoA reductase activity. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MASWAKGRSYLAPGLLQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTKQARVIPIQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVENYGSWGQSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGRSLYTHSYEVPDHDNWPKGAGDLSVVKKMKETFKEKAKL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.