131079
PDHK2 [Pyruvate Dehydrogenase [Lipoamide]] Kinase Isozyme 2, Mitochondrial, Pyruvate Dehydrogenase Kinase Isoform 2, PDH Kinase 2, PDKII, PDK2)
Size
£685.00
- SKU:
- 131079
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa187-276 from human PDK2 (AAH05811) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2G1
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- Inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 0.8ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: HIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPIKVM Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice