131065-ML650

PDGFD (Platelet-derived Growth Factor D, PDGF-D, Iris-expressed Growth Factor, Spinal Cord-derived Growth Factor B, SCDGF-B, IEGF, SCDGFB, MSTP036, UNQ1899/PRO4345, MGC26867) (MaxLight 650)

Size

£914.00

SKU:: 131065-ML650
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa24-123 from human PDGFD with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4H2
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Extra Details:: MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. The platelet-derived growth factor (PDGF) family consists of four disulfide-linked homodimers and one heterodimer (PDGF-AB). These proteins regulate diverse cellular functions through interactions with PDGF Ra and Rb. Mature PDGF-DD associates with PDGF Rb and triggers signaling through PDGF Rb homodimers and PDGF Ra/b heterodimers. The human PDGF-DD cDNA encodes a 370aa precursor that includes a 23aa signal sequence, one CUB domain, and one PDGF/VEGF domain. The PDGF/VEGF domain shares 27-35aa sequence identity with the corresponding regions of other PDGF family members. Human PDGF-DD shares 87aa sequence identity with mouse and rat PDGF-DD. PDGF-DD is secreted as a100kD latent homodimer which is activated by proteolysis to release a 35kD bioactive protein containing the PDGF/VEGF homology domain. A splice variant of PDGF-DD has a 6aa deletion near the N-terminus. A 72aa deletion within the PDGF/VEGF domain generates an inactive protein in mouse but has not been detected in human. PDGF-DD is widely expressed in embryonic and adult tissues, and PDGF Rb is expressed in a generally complementary pattern. PDGF-DD functions as a growth factor for renal artery smooth muscle cells and lens epithelial cells, and as a macrophage chemoattractant. PDGF-DD is overexpressed in and contributes to several disease states, including renal and hepatic fibrosis, mesangial proliferative glomerulopathy, pulmonary lymphoid infiltration, and many cancers. PDGF-DD functions in both paracrine and autocrine manners. Applications: Suitable for use in FLISA and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TPQSASIKALRNANLRRDDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLHSQENTRIQLVFDNQFGLEEAENDICRYDFVEVEDISETSTIIRGR Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice