PDE4C (DPDE1, cAMP-specific 3',5'-cyclic Phosphodiesterase 4C, PDE21, MGC126222)

Size

£698.00

SKU:: 131051
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-100 from human PDE4C (NP_000914) with GST tag.
Clone:: 6A10
Format:: Supplied as a liquid in ascites fluid.
Extra Details:: Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MENLGVGEGAEACSRLSRSRGRHSMTRAPKHLWRQPRRPIRIQQRFYSDPDKSAGCRERDLSPRPELRKSRLSWPVSSCRRFDLENGLSCGRRALDPQS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.