PDAP1 (28kD Heat-and Acid-stable Phosphoprotein, PDGF-associated Protein, PAP, PDGFA-associated Protein 1, PAP1, HASPP28)

Size

£685.00

SKU:: 131027
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant protein corresponding to aa1-181 from PDAP1 (AAH00684) with GST tag. *MW of the GST tag alone is 26kD.
Clone:: 3B10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Human PDAP1 encodes a deduced 181aa protein expressed in all tissues test with the exception of liver, most abundantly in brain. PDAP1 enhances PDGFA-stimulated cell growth in mouse fibroblasts, but inhibits the mitogenic effect of PDGFB. The binding between PDGFA and PDAP1 is a low affinity/high capacity interaction, as determined by sold-phase studies. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.