131027-ML650
PDAP1 (28kD Heat-and Acid-stable Phosphoprotein, PDGF-associated Protein, PAP, PDGFA-associated Protein 1, PAP1, HASPP28) (MaxLight 650)
Size
£914.00
- SKU:
- 131027-ML650
- Purity:
- Purified
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full-length recombinant protein corresponding to aa1-181 from PDAP1 (AAH00684) with GST tag. *MW of the GST tag alone is 26kD.
- Clone:
- 3B10
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. Human PDAP1 encodes a deduced 181aa protein expressed in all tissues test with the exception of liver, most abundantly in brain. PDAP1 enhances PDGFA-stimulated cell growth in mouse fibroblasts, but inhibits the mitogenic effect of PDGFB. The binding between PDGFA and PDAP1 is a low affinity/high capacity interaction, as determined by sold-phase studies. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice