PCYT1A (CTPCT, PCYT1, Choline-phosphate Cytidylyltransferase A, CCT-alpha, CTP:phosphocholine Cytidylyltransferase A, CCT A, CT A, Phosphorylcholine Transferase A)

Size

£685.00

SKU:: 131022
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa2-91 from human PCYT1A (NP_005008) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 7H8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: PCYT1A controls phosphatidylcholine synthesis. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERPVRVYADGIFDLFHS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.