PCSK6 (PACE4, Proprotein Convertase Subtilisin/Kexin Type 6, Paired Basic Amino Acid Cleaving Enzyme 4, Subtilisin-like Proprotein Convertase 4, SPC4, Subtilisin/Kexin-like Protease PACE4)

Size

£685.00

SKU:: 131011
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa860-970 from human PCSK6 (NP_002561) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2D6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: PACE4 is a Serine S8 type protease that cleaves precursor proteins at paired basic amino acid processing sites. Several PACE4 substrates have been identified, including transforming growth factor beta-related proteins, proalbumin and von Willebrand factor. At least eight alternatively spliced transcript variants encoding different isoforms have been reported. In mouse, PACE4 has been shown to increase tumor cell invasiveness, and thus enhance tumor progression. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.