131005-APC

MED15 (PCQAP, Mediator of RNA Polymerase II Transcription Subunit 15, Mediator Complex Subunit 15, Positive Cofactor 2 Glutamine/Q-rich-associated Protein, PC2 Glutamine/Q-rich-associated Protein, TPA-inducible Gene 1 Protein, TIG-1, Activator-recruited Cofactor 105kD Component, ARC105, CTG rEpeat Protein 7a, Trinucleotide Repeat-containing Gene 7 Protein, ARC105, CTG7A, TIG1, TNRC7, DKFZp686A2214, DKFZp762B1216, FLJ42282, FLJ42935) (APC)

Size

£927.00

SKU:: 131005-APC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-89 from human PCQAP (NP_056973) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4A4
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: PCQAP is a subunit of the multiprotein complexes PC2 and ARC/DRIP and may function as a transcriptional coactivator in RNA polymerase II transcription. This gene contains stretches of trinucleotide repeats and is located in the chromosome 22 region which is deleted in DiGeorge syndrome. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSL* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.