131001
PCNA-associated Factor (Hepatitis C Virus NS5A-transactivated Protein 9, HCV NS5A-transactivated Protein 9, Overexpressed in Anaplastic Thyroid Carcinoma 1, OEATC-1, PCNA-associated Factor of 15kD, PAF15, p15PAF, NS5ATP9, PAF, L5)
Size
£685.00
- SKU:
- 131001
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length human KIAA0101, aa1-112 (NP_055551.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice