130864-FITC

PAPPA (Pappalysin-1, Insulin-like Growth Factor-dependent IGF-binding Protein 4 Protease, IGF-dependent IGFBP-4 Protease, IGFBP-4ase, Pregnancy-associated Plasma Protein A, PAPP-A) (FITC)

Size

£914.00

SKU:: 130864-FITC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa85-194 from human PAPPA with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1G3
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Extra Details:: PAPP A (PAPP-A, Insulin-like growth factor binding protein-4 protease, PAPP-A-proMBP complex) was originally isolated from pregnancy serum as heterotetrameric protein complex with molecular weight approximately 500kD, consisting of two PAPP A subunits disulfide-linked with two subunits of the proform of eosinophil major basic protein (proMBP). In such a complex proMBP functions as an inhibitor of PAPP A proteinase activity. PAPP A is widely used as a marker of some pathologies during pregnancy. Low maternal serum levels of PAPP-A in first trimester biochemical screening is used as a marker of Down's syndrome (Trisomy 21). Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: GATEEPSPPSRALYFSGRGEQLRLRADLELPRDAFTLQVWLRAEGGQRSPAVITGLYDKCSYISRDRGWVVGIHTISDQDNKDPRYFFSLKTDRARQVTTINAHRSYLPG Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice